DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and B0280.17

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001040836.2 Gene:B0280.17 / 4363051 WormBaseID:WBGene00044674 Length:260 Species:Caenorhabditis elegans


Alignment Length:117 Identity:34/117 - (29%)
Similarity:64/117 - (54%) Gaps:10/117 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRS-TGDPRYAH 146
            |||.|.:.....|..|:::||:|.::|:|:::..||:.|:|:...:|..|||:||. .|   :.|
 Worm   142 KVFFPPETANNTNPVGRLIGPRGMTIRQLEKDLGCKLFIRGKGCTKDDAKEERLRERVG---WEH 203

  Fly   147 LQKDLFLEVSTVATPAECYARIAYALAEIRKYL---IPDKNDEVSHEQLREL 195
            |::.:.:.:|..:...|..:.   .|:.|:|.|   :...:.|:...||.:|
 Worm   204 LKEPIHVMISVRSDSEEAASE---KLSSIKKMLQEFLEHTDSELKRSQLMQL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 34/117 (29%)
B0280.17NP_001040836.2 KH-I 141..260 CDD:381803 34/117 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.