DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and how

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_001262822.1 Gene:how / 42596 FlyBaseID:FBgn0264491 Length:418 Species:Drosophila melanogaster


Alignment Length:276 Identity:80/276 - (28%)
Similarity:137/276 - (49%) Gaps:50/276 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TPSEFTEKQPPTHDHQPRLNEVAQKFLADLDEERQRLSADFP----LCALLIDEAVDRVYCTGRI 63
            ||...|.:|      |.:..:....:||.|.::|::|:| ||    ....|:||.:      .|:
  Fly    59 TPQHLTPQQ------QQQSTQSIADYLAQLLKDRKQLAA-FPNVFTHVERLLDEEI------ARV 110

  Fly    64 PGKEFYADVYKQKPMKI----------TQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCK 118
            ....|..:..|::|:.:          .:||:|||:::|.|||.|:||||:|.:.::|::||.||
  Fly   111 RASLFQINGVKKEPLTLPEPEGSVVTMNEKVYVPVREHPDFNFVGRILGPRGMTAKQLEQETGCK 175

  Fly   119 IAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLIP-- 181
            |.::|:.|:||:.||:..|  |.|.:.||..||.:.::...|......::|.|:||::|.|:|  
  Fly   176 IMVRGKGSMRDKKKEDANR--GKPNWEHLSDDLHVLITVEDTENRATVKLAQAVAEVQKLLVPQA 238

  Fly   182 DKNDEVSHEQLRELMEMD----PESAKNIH-----GPNLEAYRSVFDKKFGG----------NSN 227
            :..||:...||.||..::    ..:||::.     |.....|.:|.|:::..          .|.
  Fly   239 EGEDELKKRQLMELAIINGTYRDTTAKSVAAFSCVGSASYLYPAVCDEEWRRLVAASDSRLLTST 303

  Fly   228 GAPKYINLIKRAAENP 243
            |.|.....|:..|..|
  Fly   304 GLPGLAAQIRAPAAAP 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 48/124 (39%)
howNP_001262822.1 STAR_dimer 75..123 CDD:293152 14/54 (26%)
SF1_like-KH 139..260 CDD:239088 48/122 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460722
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D66954at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.