DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and qki2

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_021335713.1 Gene:qki2 / 393815 ZFINID:ZDB-GENE-040426-1462 Length:341 Species:Danio rerio


Alignment Length:218 Identity:69/218 - (31%)
Similarity:111/218 - (50%) Gaps:45/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METPSEFTEKQPPTHDHQPRLNEVAQKFLADLDEERQRLSADFPLCAL------LIDEAVDRVYC 59
            |||    .||..||.|           :|..|..:::.:|:....|.:      |:||.:.||  
Zfish     5 MET----KEKPKPTPD-----------YLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEIGRV-- 52

  Fly    60 TGRIPGKEFYADVYKQKPMKIT--------------QKVFVPVKQYPKFNFTGKILGPKGNSLRR 110
                 .|:.|.|.......|.|              :|::||||:||.|||.|:||||:|.:.::
Zfish    53 -----RKDMYNDTLNGSTDKRTSELPDAVGPIAQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQ 112

  Fly   111 LQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEI 175
            |:.||.|||.::|:.|:||:.||||.|  |.|.:.||.:||.:.::...:......::..|:.|:
Zfish   113 LEAETGCKIMVRGKGSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDSQNRAEIKLKRAVEEV 175

  Fly   176 RKYLIPDKNDEVSHEQLRELMEM 198
            :|.|:|....|.|.::: :|||:
Zfish   176 KKLLVPAAEGEDSLKKM-QLMEL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 48/132 (36%)
qki2XP_021335713.1 STAR_dimer 10..68 CDD:318695 16/75 (21%)
SF1_like-KH 83..205 CDD:239088 47/118 (40%)
PRK00708 139..299 CDD:331498 17/62 (27%)
Quaking_NLS 314..341 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590083
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.