DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and CG3927

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_611681.1 Gene:CG3927 / 37576 FlyBaseID:FBgn0034739 Length:270 Species:Drosophila melanogaster


Alignment Length:264 Identity:202/264 - (76%)
Similarity:222/264 - (84%) Gaps:6/264 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METPSEFTEKQ---PPTHDHQPRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGR 62
            ||||||.||||   .||  :||||||||||||||||.||:||||:||||||||||:|||||.|||
  Fly     1 METPSELTEKQNQDQPT--YQPRLNEVAQKFLADLDAERKRLSAEFPLCALLIDESVDRVYSTGR 63

  Fly    63 IPGKEFYADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSI 127
            |||||.:||||:||||||.|||||||.::||||||||||||||||||||||||.|||.||||:|:
  Fly    64 IPGKEPFADVYQQKPMKIIQKVFVPVNKFPKFNFTGKILGPKGNSLRRLQEETHCKIVIKGRNSM 128

  Fly   128 RDRNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQL 192
            |||||||:|||:||||||||.||||||||.||.||||||||||||||||||||||.||:|.|||.
  Fly   129 RDRNKEEELRSSGDPRYAHLHKDLFLEVSAVAPPAECYARIAYALAEIRKYLIPDDNDDVWHEQQ 193

  Fly   193 RELMEMDPESAKNIHGPNLEAYRSVFDKKFGGNSNGAPKYINLIKRAAENPPEVDDVEEVAYEY- 256
            ||||||:|:|||..:|.|:..|||.|||..|...|.||||.|.|:|..|||.||..:|||.|:| 
  Fly   194 RELMEMNPKSAKKSNGLNMAPYRSNFDKAIGAIRNRAPKYNNQIRRVTENPREVAYMEEVEYDYD 258

  Fly   257 EHRM 260
            ||.|
  Fly   259 EHLM 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 101/118 (86%)
CG3927NP_611681.1 SF1_like-KH 83..201 CDD:239088 101/117 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468732
Domainoid 1 1.000 98 1.000 Domainoid score I7099
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.