DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and qkr58E-1

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_523809.2 Gene:qkr58E-1 / 37561 FlyBaseID:FBgn0022986 Length:396 Species:Drosophila melanogaster


Alignment Length:355 Identity:122/355 - (34%)
Similarity:185/355 - (52%) Gaps:77/355 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKEFYADVYKQKPMKITQK 83
            |:|||....:|.:...|::.|.....:...|:|:.|:::..:||||..|.||:||.:||:::.||
  Fly    52 PQLNEKTNAYLQECLLEKKTLEKKHIITKRLLDDEVEKILVSGRIPKPEIYANVYSEKPIRVAQK 116

  Fly    84 VFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQ 148
            |..|:|:||||||.|||||||||:||:|||||.||:.:.||:|:||..|||:|||:|:|:||||.
  Fly   117 VLFPIKEYPKFNFVGKILGPKGNTLRQLQEETMCKMVVMGRNSMRDHGKEEELRSSGNPKYAHLS 181

  Fly   149 KDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEMDPESAKNIHGPNLEA 213
            :||.:|:||||.|||.|.||:|||.||||::|||.||::..|||||:...:....|:.|      
  Fly   182 RDLHVEISTVAPPAEAYHRISYALGEIRKFMIPDANDDIRLEQLREMDGKERMYKKSHH------ 240

  Fly   214 YRSVFDKKFGGN----------SNGAPKYINLIKRA----------------------------- 239
                :.|.:|.:          ::..||..:::::|                             
  Fly   241 ----YSKSYGDHGAYSSRTPPPASSKPKVYSILEKARYVMDDPNYGIVKTHRSRDHELYDHHGEY 301

  Fly   240 ---AENPPEVD-------DVEEVAYEYEHRMP--------------PKRPPTGYEYSKPRPSIIP 280
               |..||:..       ..:..:||.::|..              |.:|..|...|..||:  .
  Fly   302 DRYATPPPQTSKHSTHHAQYDSSSYERDYRREYHPHSSSSSYAAAYPAKPSNGRSSSSYRPT--T 364

  Fly   281 TNAAAYKRPYPTDMKRMREPPIKSYKPNPY 310
            :.:.::...:.....|.||.  ..|:..||
  Fly   365 SGSGSHSSAHYETGSRSRES--VRYRSAPY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 76/118 (64%)
qkr58E-1NP_523809.2 KH-I 109..210 CDD:412160 66/100 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468742
Domainoid 1 1.000 45 1.000 Domainoid score I3083
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.