DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and CG4021

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_611610.2 Gene:CG4021 / 37484 FlyBaseID:FBgn0034659 Length:319 Species:Drosophila melanogaster


Alignment Length:313 Identity:248/313 - (79%)
Similarity:267/313 - (85%) Gaps:15/313 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 METPSEFTEKQP-PTHDHQPRLNEVAQKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIP 64
            ||.|||.||:|| .||::||||||:|||||||||||||||||:|||||||||||.||||.|||||
  Fly     4 MENPSEITEEQPTTTHEYQPRLNEIAQKFLADLDEERQRLSAEFPLCALLIDEARDRVYATGRIP 68

  Fly    65 GKEFYADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRD 129
            |||.|||||:||||||.|||||||.|||||||.|||||||||||||||||||||||:|||||:||
  Fly    69 GKELYADVYRQKPMKIIQKVFVPVNQYPKFNFAGKILGPKGNSLRRLQEETQCKIALKGRSSMRD 133

  Fly   130 RNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRE 194
            |||||:|||  |||||||||:|||||||||.||||::||||||||||||||||.|||||||||||
  Fly   134 RNKEEELRS--DPRYAHLQKNLFLEVSTVAIPAECHSRIAYALAEIRKYLIPDNNDEVSHEQLRE 196

  Fly   195 LMEMDPESAKNIHGPNLEAYRSVFDKKFGGNSNGAPKYINLIKRAAENPPEVDDVEEVAYEY-EH 258
            |||:|||||||..|.||||||||.|      ||||.||||||||.||||.:|.|:|:|.|:| ||
  Fly   197 LMEIDPESAKNFKGLNLEAYRSVRD------SNGASKYINLIKRVAENPSKVADMEQVDYDYDEH 255

  Fly   259 RMPPKRPPTGYEYSKPRPSIIPTNAAAYKR--PYPTDMKRMREPPIKSYKPNP 309
            .|||...|||||||..|||.|   .|.:||  |||||||.:||||||.|||||
  Fly   256 HMPPIHLPTGYEYSIQRPSKI---VAKFKRPYPYPTDMKPVREPPIKFYKPNP 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 104/118 (88%)
CG4021NP_611610.2 SF1_like-KH 86..202 CDD:239088 104/117 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468731
Domainoid 1 1.000 98 1.000 Domainoid score I7099
eggNOG 1 0.900 - - E1_COG5176
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2246
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D428083at33208
OrthoFinder 1 1.000 - - FOG0008549
OrthoInspector 1 1.000 - - otm26159
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - P PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.