DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and qkia

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_571299.1 Gene:qkia / 30471 ZFINID:ZDB-GENE-990415-230 Length:383 Species:Danio rerio


Alignment Length:345 Identity:94/345 - (27%)
Similarity:151/345 - (43%) Gaps:91/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EFTEKQPPTHDHQPRLNEVAQKFLADLDEERQRLSADFPLCAL------LIDEAVDRVYCTGRIP 64
            |..|:..|:.|           :|..|..|::.:::...||.:      |:||.::||       
Zfish     7 EVKERPRPSPD-----------YLMQLLNEKKLMTSLPNLCGIFTHLERLLDEEINRV------- 53

  Fly    65 GKEFYAD----VYKQKPMK----------ITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEET 115
            .|:.|.|    :..:.|::          :.:|:|||||:||.:||.|:||||:|.:.::|:.||
Zfish    54 RKDMYNDSVNGLVDKHPLELPEPVGPIVHLQEKLFVPVKEYPDYNFVGRILGPRGLTAKQLEAET 118

  Fly   116 QCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLI 180
            .|||.::||||:||:.||||.|  |.|.:.||.:||.:.::...|......::..|:.|::|.|:
Zfish   119 GCKIMVRGRSSMRDKKKEEQNR--GKPNWEHLNEDLHVLITVEDTQTRAEIKMRRAVEEVKKLLV 181

  Fly   181 P--DKNDEVSHEQLRELMEMD-PESAKNIHGPNLEAYRSVFDKKFGGNSNGAPKYINLIKRAAEN 242
            |  :..|.:...||.||..:: .....||..|.|     .|.......:...|:.|      |..
Zfish   182 PAAEGEDNLKKMQLMELAILNGTYRDTNIKAPTL-----AFSLAAAAAAAQGPRLI------AAP 235

  Fly   243 PPEVDDVEEVAYEYEHRMPPK--RPPTG-----YEYSKP----------RPSIIPTNAAA----- 285
            |.:|             :||.  ||||.     ....:|          .|:::|....|     
Zfish   236 PGQV-------------LPPATLRPPTPAGTPIMNIIRPTQMATVLPNGTPTLVPPTPDAGIIYT 287

  Fly   286 --YKRPYPTDMKRMREPPIK 303
              |..||......:.|.||:
Zfish   288 TPYDYPYALAPTSLLEYPIE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 50/121 (41%)
qkiaNP_571299.1 STAR_dimer 11..69 CDD:293152 15/75 (20%)
SF1_like-KH 84..206 CDD:239088 50/123 (41%)
Quaking_NLS 356..383 CDD:293159
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590107
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.