DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and F54D1.1

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_502114.1 Gene:F54D1.1 / 186227 WormBaseID:WBGene00010046 Length:278 Species:Caenorhabditis elegans


Alignment Length:151 Identity:38/151 - (25%)
Similarity:68/151 - (45%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 KVFVPVKQYP--------KFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRST 139
            ||::|  :.|        |.|:.|:||||.|.|.|.::.:....:.|:|..|:|::..:|::|. 
 Worm   135 KVYIP--EPPVSIDGKKVKCNYIGRILGPSGMSARMIENQYDVTLLIRGAGSVRNKAMDERVRK- 196

  Fly   140 GDPRYAHLQKDL-FLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQL----------- 192
               |..||::.| .|.::......:|...:..|..:|...|.| .:||...:||           
 Worm   197 ---RNEHLEEPLHVLLIARHNDKTKCEEILNKAAEKIESLLTP-IHDEYKMDQLVSYAKMNGTYQ 257

  Fly   193 ---RELMEMDPESAKNIHGPN 210
               :...::|.:|..|...|:
 Worm   258 ERPKRKSQLDEQSHSNYWAPH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 34/139 (24%)
F54D1.1NP_502114.1 SF1_like-KH 133..257 CDD:239088 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.