DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and sfa-1

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_503033.1 Gene:sfa-1 / 178486 WormBaseID:WBGene00013808 Length:699 Species:Caenorhabditis elegans


Alignment Length:233 Identity:60/233 - (25%)
Similarity:109/233 - (46%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSEFTEKQPPTHDHQPRLNEVAQKF-LAD--LDEERQRLSADFPLCALLIDEAVDRVYCTGRI-- 63
            |::.||.|...:..|..:.:..:|. |||  :.|.|:|..:..|     :.:|..:...|..:  
 Worm   209 PADLTEDQRNAYLLQLEIEDATRKLRLADFGVAEGRERSPSPEP-----VYDANGKRLNTREVRK 268

  Fly    64 -------------------PGKEFYADVYKQKPMKITQKVFVPVKQYPKFNFTGKILGPKGNSLR 109
                               |..:..|| |:...:::..||::|.:|:|..||.|.::||:||:|:
 Worm   269 RQELEQLRHEKIQALLKINPNFKPPAD-YRAPNIRLHDKVWIPQEQFPDLNFVGLLIGPRGNTLK 332

  Fly   110 RLQEETQCKIAIKGRSSIRD---RNKEEQLRSTGDPRYAHLQKDLFLEVSTVATPAECYARIAYA 171
            .|:.||..||.|:|:.||::   .|:...:....:|.:|::..   .:::.:....|   :|...
 Worm   333 SLEAETGAKIIIRGKGSIKEGKLTNRLGPMPGENEPLHAYVTG---TDMNVIKKACE---KIKQV 391

  Fly   172 LAEIRKYLIPDKNDEVSHEQLRELMEMD----PESAKN 205
            :||..  .:|| |:|:...|||||..::    ||...|
 Worm   392 IAEAT--ALPD-NNELRKLQLRELALLNGTFRPEDLAN 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 38/125 (30%)
sfa-1NP_503033.1 MSL5 185..422 CDD:227503 57/227 (25%)
PTZ00368 <427..>471 CDD:173561 60/233 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.760

Return to query results.
Submit another query.