DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and B0280.11

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_498560.2 Gene:B0280.11 / 175997 WormBaseID:WBGene00015106 Length:441 Species:Caenorhabditis elegans


Alignment Length:144 Identity:37/144 - (25%)
Similarity:54/144 - (37%) Gaps:44/144 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 MKITQKVFVPVKQYPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDP 142
            |::|.|.|...|...|              |.:.:|||.   ..|..|:|..|..|.|:..:|: 
 Worm    71 MEVTAKGFKKAKDAKK--------------LEKKKEETG---PSKTPSTIALRRAESQMELSGN- 117

  Fly   143 RYAHLQKDLFLEVSTVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEMDPESA---- 203
                 :|::...|.|.....|       .|.||||.|      |...:.: :.|::|.|..    
 Worm   118 -----RKNVEKGVKTWVEQLE-------KLVEIRKLL------EADFKPI-DTMKVDLEKCQAFK 163

  Fly   204 KNI---HGPNLEAY 214
            |||   ...|:|.|
 Worm   164 KNIDYCQSENVELY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 28/118 (24%)
B0280.11NP_498560.2 PTPc 141..398 CDD:214550 11/44 (25%)
PTPc 177..394 CDD:304379 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.731683 Normalized mean entropy S1317
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.