DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and KHDRBS3

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_006549.1 Gene:KHDRBS3 / 10656 HGNCID:18117 Length:346 Species:Homo sapiens


Alignment Length:270 Identity:98/270 - (36%)
Similarity:144/270 - (53%) Gaps:28/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKEFYADVYKQKPMKITQKVFVPVKQ 90
            :|:|.:|..|:..|...|.....|:::.::: :..|....:|.|.||...|.||:.|||.:||||
Human     3 EKYLPELMAEKDSLDPSFTHALRLVNQEIEK-FQKGEGKDEEKYIDVVINKNMKLGQKVLIPVKQ 66

  Fly    91 YPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEV 155
            :|||||.||:|||:||||:||||||..|::|.|:.|:||:.|||:||.:|:.:|.||..||.:.:
Human    67 FPKFNFVGKLLGPRGNSLKRLQEETLTKMSILGKGSMRDKAKEEELRKSGEAKYFHLNDDLHVLI 131

  Fly   156 STVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEMDPES---------------AKN 205
            ...|.|||.|||:.:||.||:|:||||.|||:...||:||..::..|               .:.
Human   132 EVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGSENADVPVVRGKPTLRTRG 196

  Fly   206 IHGPNLEAYRSVFDKKFGGNSNGAPKYINLIKRAAENPPEVDDVEEVAYEYEHRMPPKR---PPT 267
            :..|.:...|        |.....|..: ::.|....|..|.............:.|:.   |||
Human   197 VPAPAITRGR--------GGVTARPVGV-VVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPT 252

  Fly   268 GYEYSKPRPS 277
            ||....|.|:
Human   253 GYRPPPPPPT 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 67/118 (57%)
KHDRBS3NP_006549.1 Involved in homodimerization. /evidence=ECO:0000269|PubMed:26758068 1..160 75/157 (48%)
Qua1 4..53 CDD:406639 12/49 (24%)
KH-I_KHDRBS3 48..160 CDD:411898 64/111 (58%)
Interaction with SIAH1. /evidence=ECO:0000269|PubMed:15163637 212..251 5/39 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..267 12/51 (24%)
Sam68-YY 266..320 CDD:406871
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..346
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155047
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 168 1.000 Inparanoid score I4151
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8456
orthoMCL 1 0.900 - - OOG6_110428
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.