DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-3 and khdrbs3

DIOPT Version :9

Sequence 1:NP_001246460.1 Gene:qkr58E-3 / 37559 FlyBaseID:FBgn0022984 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_002932263.1 Gene:khdrbs3 / 100379996 XenbaseID:XB-GENE-941483 Length:342 Species:Xenopus tropicalis


Alignment Length:290 Identity:101/290 - (34%)
Similarity:152/290 - (52%) Gaps:41/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 QKFLADLDEERQRLSADFPLCALLIDEAVDRVYCTGRIPGKEFYADVYKQKPMKITQKVFVPVKQ 90
            :|:|..|..|:..|...|.....::.|.::::. .|....::.|.||...|.||:.|||.:|:||
 Frog     2 EKYLPQLLAEKDALDPSFTHALRMVKEEIEKLQ-KGEDNTEDQYIDVVINKNMKLAQKVLIPIKQ 65

  Fly    91 YPKFNFTGKILGPKGNSLRRLQEETQCKIAIKGRSSIRDRNKEEQLRSTGDPRYAHLQKDLFLEV 155
            :|||||.||:|||:||||:||||:|..|::|.|:.|:||:.|||:||.:|:.:|.||..||.:.:
 Frog    66 FPKFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKAKEEELRKSGEAKYYHLNDDLHVLI 130

  Fly   156 STVATPAECYARIAYALAEIRKYLIPDKNDEVSHEQLRELMEMD--PES--AKNIHG-PNLEAYR 215
            ...|.|||.|||:.:||.||:|:||||.|||:...||:||..::  ||:  |..:.| |::.|  
 Frog   131 EVFAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNGGPETTEAPVVRGKPSIRA-- 193

  Fly   216 SVFDKKFGGNSNGAPKYINLIKRAAENPPEVDDVEEVAYEYEHRMPPKRPPTGYEYSKPRP-SII 279
                       .|.|  :..:.|....                 :||  .|||.....|.| .:.
 Frog   194 -----------RGVP--VPALPRGRGG-----------------VPP--APTGVPRGAPAPRGVT 226

  Fly   280 PTNAAAYKRPYPTDMKRMREPPIKSYKPNP 309
            |...::.:.......:....||...|:|.|
 Frog   227 PARVSSARARGLVATRARGIPPPAGYRPPP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-3NP_001246460.1 SF1_like-KH 81..200 CDD:239088 65/120 (54%)
khdrbs3XP_002932263.1 Qua1 3..52 CDD:374463 11/49 (22%)
SF1_like-KH 57..176 CDD:239088 65/118 (55%)
PHA03381 <193..>233 CDD:177618 12/73 (16%)
Sam68-YY 262..316 CDD:374636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10668
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9347
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.