DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6044 and wrk-1

DIOPT Version :10

Sequence 1:NP_611668.1 Gene:CG6044 / 37558 FlyBaseID:FBgn0034725 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001024651.1 Gene:wrk-1 / 181093 WormBaseID:WBGene00006942 Length:452 Species:Caenorhabditis elegans


Alignment Length:105 Identity:22/105 - (20%)
Similarity:41/105 - (39%) Gaps:11/105 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 VPQNATSAKLECPVKNYNAAHHVVLWYKEKVQVSSGMNIFNHI--YALDEQFS---LTVPLASNA 154
            :.:...|..|.|.|::.:.|   ::|.|....|:....|.:..  |.:..:.|   ||:......
 Worm    28 IAKEGESLTLRCEVEDPSVA---IIWRKNTEVVAVDDEILDTYGGYEISMEGSTSVLTIKRVEPI 89

  Fly   155 TEERYECEVLPNKVRHTATIR---FGPEPSTPAPSLLPAP 191
            ....|.|.:...:|..|..|:   |.|...:..|.::.:|
 Worm    90 NSANYSCALAEPEVSVTFVIKVQVFKPTQVSVKPLVVISP 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6044NP_611668.1 None
wrk-1NP_001024651.1 IG_like 25..113 CDD:214653 18/87 (21%)
Ig strand B 35..39 CDD:409353 1/3 (33%)
Ig strand C 47..51 CDD:409353 1/6 (17%)
Ig strand E 77..83 CDD:409353 2/5 (40%)
Ig strand F 93..98 CDD:409353 2/4 (50%)
Ig strand G 104..107 CDD:409353 0/2 (0%)
Ig 136..212 CDD:472250
Ig strand B 143..147 CDD:409353
Ig strand C 157..161 CDD:409353
Ig strand E 178..182 CDD:409353
Ig strand F 192..197 CDD:409353
Ig 235..319 CDD:472250
Ig strand C 254..258 CDD:409353
Ig strand E 278..291 CDD:409353
Ig strand F 301..306 CDD:409353
Ig strand G 314..317 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.