DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and KIRREL3

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:158 Identity:32/158 - (20%)
Similarity:57/158 - (36%) Gaps:33/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DFDYGGEDQSAPSPQTKSPNPVASEKINKTLSV-TGIR------------GEDVVLKCDVGSNLH 90
            |:.|..|..|.     :..|.:.|..:::|:.| .|.|            |.|.:..|....|  
Human   310 DYTYFSEPVSC-----EVTNALGSTNLSRTVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGN-- 367

  Fly    91 SSDVVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSYLCK-VLPSGSVVNTKVTI 154
             ..:.::|      :..|..:|..|.|     .||:.....:.||.|:|: |:|.......:||:
Human   368 -PSLTIVW------MKRGSGVVLSNEK-----TLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTL 420

  Fly   155 AEHSLDAIAPESSTSAAGSASSFLGCTV 182
            ..:....|:...:..|.......:.|.:
Human   421 TVNGPPIISSTQTQHALHGEKGQIKCFI 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 21/97 (22%)
IG_like 70..154 CDD:214653 21/97 (22%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352
Ig2_KIRREL3-like 171..252 CDD:143236
Ig_2 260..337 CDD:290606 7/31 (23%)
I-set 341..422 CDD:254352 20/94 (21%)
IGc2 355..406 CDD:197706 15/64 (23%)
Ig5_KIRREL3 424..521 CDD:143306 3/25 (12%)
IG_like 432..521 CDD:214653 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.