DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and KIRREL2

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:188 Identity:45/188 - (23%)
Similarity:64/188 - (34%) Gaps:54/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQS-------APSPQTKSPNPVASEKINKTLS 70
            |.:|..|:.::.|.|....:.:        |..::|       .|..|.| |.||:.:.      
Human   276 LEVVADASFLTEPVSCEVSNAV--------GSANRSTALDVLFGPILQAK-PEPVSVDV------ 325

  Fly    71 VTGIRGEDVVLKCDVGSNLHSSDVVVLW--YFGDNVISNGKNLVQPNFKLDANYDLTILKASPQV 133
                 |||....|....|....   |.|  ..|..|:.:|..|..|:             ..|:.
Human   326 -----GEDASFSCAWRGNPLPR---VTWTRRGGAQVLGSGATLRLPS-------------VGPED 369

  Fly   134 AGSYLCKVLPSGSVVNTKVTIAEHSLDAIAPESSTSAAGSASSF------LGCTVLAS 185
            ||.|:|:.  ...:...:...||..|...||...| |..||.:|      |.|.|.||
Human   370 AGDYVCRA--EAGLSGLRGGAAEARLTVNAPPVVT-ALHSAPAFLRGPARLQCLVFAS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 17/85 (20%)
IG_like 70..154 CDD:214653 17/85 (20%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653
IGc2 38..106 CDD:197706
I-set 126..224 CDD:254352
Ig2_KIRREL3-like 141..223 CDD:143236
Cell attachment site. /evidence=ECO:0000255 149..151
Ig 231..306 CDD:299845 7/37 (19%)
IG_like 234..308 CDD:214653 7/39 (18%)
Ig 312..395 CDD:299845 26/112 (23%)
I-set 317..395 CDD:254352 24/107 (22%)
Ig 397..501 CDD:299845 12/29 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.