DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and Kirrel3

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_006510620.1 Gene:Kirrel3 / 67703 MGIID:1914953 Length:803 Species:Mus musculus


Alignment Length:155 Identity:31/155 - (20%)
Similarity:60/155 - (38%) Gaps:27/155 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DFDYGGEDQSAPSPQTKSPNPVASEKINKTLSV---TGIRGEDVVLKCDVGSN-------LHSSD 93
            |:.|..|..|.     :..|.:.|..:::|:.|   ..:..|...|..|:||:       :.:..
Mouse   304 DYTYFSEPVSC-----EVTNALGSTNLSRTVDVYFGPRMTSEPQSLLVDLGSDAVFSCAWIGNPS 363

  Fly    94 VVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSYLCK-VLPSGSVVNTKVTIAEH 157
            :.::|      :..|..:|..|.|     .||:.....:.||.|:|: |:|.......:||:..:
Mouse   364 LTIVW------MKRGSGVVLSNEK-----TLTLKSVRQEDAGKYVCRAVVPRVGAGEREVTLTVN 417

  Fly   158 SLDAIAPESSTSAAGSASSFLGCTV 182
            ....|:...:..|.......:.|.:
Mouse   418 GPPIISSTQTQHALHGEKGQIKCFI 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 20/94 (21%)
IG_like 70..154 CDD:214653 20/94 (21%)
Kirrel3XP_006510620.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416
Ig strand E 210..214 CDD:409416
Ig strand F 224..229 CDD:409416
Ig strand G 239..242 CDD:409416
Ig <267..334 CDD:416386 8/34 (24%)
Ig strand B 267..274 CDD:409353
Ig strand C 279..286 CDD:409353
Ig strand C' 288..291 CDD:409353
Ig strand D 298..302 CDD:409353
Ig strand E 304..310 CDD:409353 2/5 (40%)
Ig strand G 321..334 CDD:409353 3/12 (25%)
Ig 335..416 CDD:416386 20/91 (22%)
Ig strand A' 343..347 CDD:409353 1/3 (33%)
Ig strand B 350..360 CDD:409353 1/9 (11%)
Ig strand C 365..371 CDD:409353 1/11 (9%)
Ig strand E 381..387 CDD:409353 3/10 (30%)
IgI_5_KIRREL3 418..515 CDD:409479 3/25 (12%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479
Ig strand E 481..485 CDD:409479
Ig strand F 496..501 CDD:409479
Ig strand G 509..512 CDD:409479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.