DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and IGSF9

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001128522.1 Gene:IGSF9 / 57549 HGNCID:18132 Length:1179 Species:Homo sapiens


Alignment Length:247 Identity:50/247 - (20%)
Similarity:77/247 - (31%) Gaps:92/247 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DQMQADDDFDYGG----------EDQSAP---------SPQT------KSPNPVASEKI------ 65
            ||...:|||..|.          :.|..|         .|.|      .||.|..:.|:      
Human   114 DQHIPEDDFANGSWVHLTVNSPPQFQETPPAVLEVQELEPVTLRCVARGSPLPHVTWKLRGKDLG 178

  Fly    66 ---------NKTLSVTGI-RGEDVVLKCDV----GSNLHSSDVVVL------------------- 97
                     |.||.:..: ||...|..|..    ||..|::.::||                   
Human   179 QGQGQVQVQNGTLRIRRVERGSSGVYTCQASSTEGSATHATQLLVLGPPVIVVPPKNSTVNASQD 243

  Fly    98 -----------------WYFGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSG 145
                             | |.||:.....:.:||..::..:..|.:|...|..||.|.|  :||.
Human   244 VSLACHAEAYPANLTYSW-FQDNINVFHISRLQPRVRILVDGSLRLLATQPDDAGCYTC--VPSN 305

  Fly   146 SVVNTK------VTIAEHSLDAIAPESSTSAAGSASSFLGCTVLASTVLLLL 191
            .:::..      ..:....:.|:.||  |.........:.|.|.|:..||.:
Human   306 GLLHPPSASAYLTVLYPAQVTAMPPE--TPLPIGMPGVIRCPVRANPPLLFV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 24/130 (18%)
IG_like 70..154 CDD:214653 24/130 (18%)
IGSF9NP_001128522.1 Ig 24..132 CDD:299845 6/17 (35%)
IG_like 28..110 CDD:214653
I-set 136..223 CDD:254352 18/86 (21%)
Ig 154..220 CDD:143165 15/65 (23%)
Ig_3 226..305 CDD:290638 14/81 (17%)
IG_like 233..319 CDD:214653 15/88 (17%)
Ig 341..404 CDD:299845 5/15 (33%)
IG_like 431..503 CDD:214653
Ig 436..500 CDD:143165
fn3 511..596 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 606..626
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..919
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..988
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1015..1079
PDZ-binding. /evidence=ECO:0000250 1177..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.