DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and CG34353

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:122 Identity:34/122 - (27%)
Similarity:61/122 - (50%) Gaps:15/122 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EDQSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNG- 108
            |..||.|..||: .|:.   |:::.:...|.||.:||.|:|.   ::...||.|..|..:::.| 
  Fly    73 ESVSAQSMMTKN-EPMF---ISRSETFKFITGETIVLPCEVA---NTDTYVVAWKRGIAILTAGS 130

  Fly   109 -KNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAIAP 164
             |....|..:|...::|.|..|.|..||.|:|::   .::...::|   |:::.:.|
  Fly   131 VKVTPDPRVRLVNGFNLQIRDALPTDAGDYICQI---ATMDPREIT---HTVEILVP 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 23/85 (27%)
IG_like 70..154 CDD:214653 23/85 (27%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 24/88 (27%)
Ig 103..177 CDD:143165 22/82 (27%)
IG_like 191..269 CDD:214653
IGc2 198..258 CDD:197706
I-set 273..360 CDD:254352
Ig 290..359 CDD:143165
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.