DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and aebp1b

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:168 Identity:40/168 - (23%)
Similarity:68/168 - (40%) Gaps:29/168 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSRTDLLIAGLLLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQSAPSP----QTKSPNPVA 61
            :.::..|::..|.|:|.|..|....:.|..:   .:..|.:...||::..|.    |.|...|.|
Zfish     4 LRNQKTLVVLCLSLLVPSWEVNGLTEHSKSE---ISHTDREQHVEDRNVTSVEDLLQVKIIPPYA 65

  Fly    62 SEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYF--GDNVISNGKNLVQPNFKLDANYDL 124
            :.::          |:...|.|.|.|:..:    :.|..  |:.|::...||...|.. .....|
Zfish    66 TIEV----------GQHKQLLCKVSSDAKN----INWVSPNGEKVLTKHGNLKVHNHG-SVLSSL 115

  Fly   125 TILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAI 162
            |:|.|:...||.|.| |..:|. ..::.|:   .||.|
Zfish   116 TVLNANLNNAGIYKC-VATNGD-TESQATV---KLDII 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 21/85 (25%)
IG_like 70..154 CDD:214653 21/85 (25%)
aebp1bXP_696022.6 Ig 56..147 CDD:299845 27/110 (25%)
IG_like 62..145 CDD:214653 24/102 (24%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.