DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and KIRREL1

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:149 Identity:36/149 - (24%)
Similarity:58/149 - (38%) Gaps:30/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NPVASEKINKTLSV--------------TGIRGEDVVLKCD-VGSNLHSSDVVVLWYFGDNVISN 107
            |.|.|..::..::|              |.| |.||.|.|. ||    :..:.:.|...|:.:..
Human   291 NKVGSTNVSTLVNVHFAPRIVVDPKPTTTDI-GSDVTLTCVWVG----NPPLTLTWTKKDSNMGP 350

  Fly   108 GKNLVQPNFKLDA----NYDLTILKASPQV-AGSYLCK-VLPSGSVVNTKVTIAEHSLDAIAPES 166
            ......|...|.|    |.:..:||:..|. ||:|.|: ::|...|...:|.:..:....|:.|:
Human   351 RPPGSPPEAALSAQVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPIISSEA 415

  Fly   167 STSA----AGSASSFLGCT 181
            ...|    .|....|:|.|
Human   416 VQYAVRGDGGKVECFIGST 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 26/104 (25%)
IG_like 70..154 CDD:214653 26/104 (25%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236
I-set 223..304 CDD:254352 3/12 (25%)
Ig_2 227..305 CDD:290606 3/13 (23%)
Ig_2 311..405 CDD:290606 25/98 (26%)
IG_like 314..405 CDD:214653 25/95 (26%)
Ig5_KIRREL3 407..504 CDD:143306 7/28 (25%)
IG_like 416..504 CDD:214653 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.