DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and opcml

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:158 Identity:40/158 - (25%)
Similarity:66/158 - (41%) Gaps:32/158 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 DQSAPSPQTKSPN----PVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVIS 106
            |.|.|..:|....    ||.| :...|.:..|.:|   ||.|: .|.:..:|  ..|:.|:..|.
Zfish   203 DISPPDVRTVQVTVNYPPVIS-RARSTGTAVGQKG---VLWCE-ASAVPLAD--FQWFKGERRIL 260

  Fly   107 NGKNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTI----AEHSLD--AIAPE 165
            ||.|.|:...|...:. ||....|.:..|:|.|..:.:..:.|..:.:    |.|.::  |::|.
Zfish   261 NGFNGVKIENKGKQSM-LTFFNVSEEDYGNYTCVAINTLGITNASIILYGPGAIHDVNNAALSPT 324

  Fly   166 SSTSAAGSASSFLGCTVLASTVLLLLGM 193
                          |::|..|:||.|.:
Zfish   325 --------------CSLLLLTLLLTLSL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 22/83 (27%)
IG_like 70..154 CDD:214653 22/83 (27%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845
IG_like 41..129 CDD:214653
IG_like 139..216 CDD:214653 4/12 (33%)
IGc2 146..202 CDD:197706
I-set 219..307 CDD:254352 26/95 (27%)
ig 223..307 CDD:278476 24/91 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.