DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and negr1

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:171 Identity:44/171 - (25%)
Similarity:72/171 - (42%) Gaps:30/171 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DFDYGGEDQSAPSPQTKSPN------PVASEKINKTLSVTGIR-GEDVVLKCDVGSNLHSSDVVV 96
            |::.|.|:..| ||.||:..      |...|     :...|:| |:..:|:|:..:   ....|.
Zfish   201 DYECGAENDIA-SPDTKTVRVTVNFPPAIHE-----MKSHGVRPGQVALLRCEAAA---VPSPVF 256

  Fly    97 LWYFGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDA 161
            .||.|:..|:.|:.:|..|  |.:...||:...:....|:|.|..:......|..|     .|:.
Zfish   257 EWYKGEKRINMGQGIVINN--LSSRSVLTVKNMTQDRYGNYTCVAVNRLGTANASV-----PLNP 314

  Fly   162 IAPESSTSAAGSASS---FLGCT----VLASTVLLLLGMGA 195
            |...::|||..|.:|   ..|.|    ||.:...|:|.:.:
Zfish   315 IIEPTTTSAVSSPASNPAMYGSTGGAEVLLACWYLILALSS 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 21/84 (25%)
IG_like 70..154 CDD:214653 21/84 (25%)
negr1XP_009300786.1 Ig 42..121 CDD:299845
IG_like 44..136 CDD:214653
I-set 140..222 CDD:254352 8/21 (38%)
IGc2 153..208 CDD:197706 2/6 (33%)
IG_like 236..312 CDD:214653 20/85 (24%)
IGc2 238..304 CDD:197706 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.