DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and Dscam3

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:204 Identity:39/204 - (19%)
Similarity:83/204 - (40%) Gaps:35/204 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DLLIAGLLLIVGSAAVIS-----YPQSSMDDDQMQADDDFD------YGGEDQSAPSPQ------ 53
            ::|:..|..:.|...|::     |.:|...:|.:.   .|.      ..||.|.:.:..      
  Fly   179 EILLPDLSDVAGRYVVLAASGDLYVRSVRSEDGLM---KFSCLVTNTLNGERQRSDAVMLQVKEL 240

  Fly    54 TKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNL--VQPNF 116
            :|:..|..::|  ..:.:...||.||.|.|::..|...   :..||    .:|:...|  :..:.
  Fly   241 SKNLAPRTTQK--PVMEIHVERGNDVHLPCNIQGNPFP---IFTWY----RVSDSAALYPIPSSQ 296

  Fly   117 KLDANYDLTILK-ASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDA--IAPESSTSAAGSASSFL 178
            ::..:..|.::| |..:.||.::|:..........::.::.:|..:  |.|:.....:|..::| 
  Fly   297 RVILSRTLLLIKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHILPQVQIVNSGGTANF- 360

  Fly   179 GCTVLASTV 187
            .||...|.:
  Fly   361 NCTTTGSAI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 17/86 (20%)
IG_like 70..154 CDD:214653 17/86 (20%)
Dscam3NP_996226.2 IG 56..133 CDD:214652
Ig 56..125 CDD:143165
I-set 246..337 CDD:254352 19/99 (19%)
Ig 264..334 CDD:143165 14/76 (18%)
I-set 345..433 CDD:254352 7/26 (27%)
Ig 358..431 CDD:143165 4/13 (31%)
Ig 456..533 CDD:143165
IGc2 553..619 CDD:197706
I-set 634..724 CDD:254352
ig 645..712 CDD:278476
IG_like 734..815 CDD:214653
Ig 745..815 CDD:299845
I-set 820..913 CDD:254352
Ig 838..920 CDD:299845
FN3 917..1033 CDD:238020
FN3 1040..1142 CDD:238020
fn3 1150..1237 CDD:278470
FN3 1263..1345 CDD:238020
Ig 1350..1436 CDD:299845
IG_like 1358..1436 CDD:214653
FN3 1441..1530 CDD:238020
FN3 1542..1620 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.