DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and dpr5

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:186 Identity:40/186 - (21%)
Similarity:65/186 - (34%) Gaps:43/186 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLIVGSAAVISYPQSSMDDDQMQADDDFDY--GGEDQSAPSPQT-KSPNPVASEKINKTLSVTG 73
            ||:|:|..|.:       |....::...|.:  ..|:.|...|.. .:.:||.....::  .|..
  Fly    47 LLVIMGLTAPV-------DKQSRRSSQYFGHLAAAEELSNLIPDNYDAIDPVFDNTTDR--EVIA 102

  Fly    74 IRGEDVVLKCDVGSNLHSSDVVVLWY---------FGDNVISNGKNLVQPNFKLDANYDLTILKA 129
            ..|....|.|.|   .|..|..|.|.         .|....:|.:..:..:......:.|.|:..
  Fly   103 ALGTTARLHCRV---RHLGDRAVSWIRQRDLHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSV 164

  Fly   130 SPQVAGSYLCKVL--PSGS------VVNTKVTI-----------AEHSLDAIAPES 166
            ..:.||.|.|:|.  |..|      ||.:|..|           ::.:|..|||::
  Fly   165 QQRDAGVYECQVSTEPKISLAYKLVVVTSKAQILANRELFIQSGSDINLTCIAPQA 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 23/100 (23%)
IG_like 70..154 CDD:214653 23/100 (23%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 20/100 (20%)
IG_like 98..179 CDD:214653 18/85 (21%)
IG_like 206..278 CDD:214653 4/15 (27%)
Ig 211..278 CDD:143165 4/10 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.