DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and CG7166

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001262181.1 Gene:CG7166 / 40401 FlyBaseID:FBgn0037107 Length:467 Species:Drosophila melanogaster


Alignment Length:140 Identity:38/140 - (27%)
Similarity:62/140 - (44%) Gaps:12/140 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNG--KNLVQP 114
            |.|.:|..::...:.|.     |.||.:.|.|.| .||.|  .|:||..|.:|::.|  |.....
  Fly    34 PPTTAPKFLSRGHLYKV-----IVGETIELPCKV-QNLGS--FVLLWRKGSSVLTAGHLKITRDQ 90

  Fly   115 NFKLDANYDLTILKASPQVAGSYLCKV--LPSGSVVNTKVTIAEHSLDAIAPESSTSAAGSASSF 177
            .||:..:|:|.|.....|.||.|:|::  ..:...|:|...:...:|.|:......:|...::..
  Fly    91 RFKIVGDYNLQINGVKTQDAGDYICQLGDQENRDQVHTVEILVPPTLRALPHNGQVTARKGSTVT 155

  Fly   178 LGCTVLASTV 187
            |.|....:.|
  Fly   156 LECKASGNPV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 28/87 (32%)
IG_like 70..154 CDD:214653 28/87 (32%)
CG7166NP_001262181.1 IG_like 50..133 CDD:214653 28/90 (31%)
Ig 56..116 CDD:143165 22/62 (35%)
IG_like 144..221 CDD:214653 4/22 (18%)
IGc2 151..209 CDD:197706 3/15 (20%)
IG_like 232..313 CDD:214653
Ig 242..311 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.