DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and dpr10

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_729591.1 Gene:dpr10 / 39180 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster


Alignment Length:195 Identity:48/195 - (24%)
Similarity:76/195 - (38%) Gaps:54/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QMQADDDFDYGGED---QSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDV 94
            |...:||..|..|:   ||:.........|:.:..: .|.::.|  |.|  |..|.||.::.:.:
  Fly   166 QQYYNDDAFYIAENRVYQSSNDEFAGMFGPIQTVAV-PTATILG--GPD--LYVDKGSTINLTCI 225

  Fly    95 V---------VLWYFGDNVIS---NGKNLVQPNFKLDAN------YDLTILKASPQVAGSYLCKV 141
            :         :.||..|.|:|   :|..|.....|.:..      ||..:|.     :|.|.|  
  Fly   226 IKFSPEPPTHIFWYHQDKVLSEETSGGRLKFKTIKSEETKSILLIYDADLLH-----SGKYSC-- 283

  Fly   142 LPSGSVVNTKV-TIAEHSLDAIAPESSTSAAGSASSFLGC----------------TVLASTVLL 189
            .||    ||:: :|..|.|....||:..:.|..|:..|.|                |::|:.|||
  Fly   284 YPS----NTEIASIRVHVLQGERPEAMQTNAAPAAVALACWSCHFGQATQAVRVISTMVAALVLL 344

  Fly   190  189
              Fly   345  344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 25/102 (25%)
IG_like 70..154 CDD:214653 25/102 (25%)
dpr10NP_729591.1 Ig 63..143 CDD:299845
IG_like 210..297 CDD:214653 24/99 (24%)
IGc2 217..287 CDD:197706 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.