DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and wrapper

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:171 Identity:40/171 - (23%)
Similarity:64/171 - (37%) Gaps:48/171 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMSRTDLLIAGLLLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQSAPSPQTKS-PNPVASEK 64
            |.|....|:|.|:|                 .|:||:.||:...|:    |.:.|| |..|    
  Fly     5 MCSVVRCLLAALIL-----------------GQVQAELDFNNDLEN----SQKFKSIPTTV---- 44

  Fly    65 INKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQP---NFKLDANYDLTI 126
              ||     ...:.|.|.|    .|::....|.|:..|..:.:.::...|   ...|..|..|.:
  Fly    45 --KT-----YENDTVQLPC----TLNTPFRYVRWHRDDVALVDSRHPELPPPDRIMLWPNGSLQV 98

  Fly   127 LKASPQVAGSYLCKV-LPSGSVVNTKVTIAEHSLDA-IAPE 165
            ........|.|.|:: ..||.||.      :|:::. :||:
  Fly    99 ANVQSSDTGDYYCEMNSDSGHVVQ------QHAIEVQLAPQ 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 18/87 (21%)
IG_like 70..154 CDD:214653 18/87 (21%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 22/103 (21%)
IG_like 41..118 CDD:214653 18/91 (20%)
IG_like 145..218 CDD:214653
Ig 147..219 CDD:299845
I-set 224..323 CDD:254352
IGc2 236..314 CDD:197706
FN3 339..431 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.