DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Lac

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	NP_523713.2	Gene:	Lac / 36363	FlyBaseID:	FBgn0010238	Length:	359	Species:	Drosophila melanogaster

Alignment Length:	141	Identity:	32/141 - (22%)
Similarity:	55/141 - (39%)	Gaps:	21/141 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 QSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDN---VISNG 108
            |...:.:|.:.:.:..|:|...       |..|...|.|   .::.:..||:...|:   .:|.|
  Fly    21 QQTLAQRTPTISYITQEQIKDI-------GGTVEFDCSV---QYAKEYNVLFLKTDSDPVFLSTG 75

  Fly   109 KNLVQPNFKLDANYD-------LTILKASPQVAGSYLCKVLPSG-SVVNTKVTIAEHSLDAIAPE 165
            ..||..:.:....||       |.|.......||:|.|:|:.|. ..|:.:|.::......|:..
  Fly    76 STLVIKDSRFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDN 140

  Fly   166 SSTSAAGSASS 176
            |:.|...|..|
  Fly   141 STQSVVASEGS 151

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	23/94 (24%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	23/94 (24%)
Lac	NP_523713.2	IG_like	36..131	CDD:214653	25/104 (24%)
		FR1	37..50	CDD:409353	4/19 (21%)
		Ig strand A'	37..42	CDD:409353	2/4 (50%)
		Ig strand B	44..51	CDD:409353	1/6 (17%)
		CDR1	51..59	CDD:409353	1/10 (10%)
		Ig strand C	59..63	CDD:409353	2/3 (67%)
		FR2	60..63	CDD:409353	2/2 (100%)
		CDR2	67..81	CDD:409353	4/13 (31%)
		Ig strand C'	68..72	CDD:409353	0/3 (0%)
		Ig strand C'	79..81	CDD:409353	1/1 (100%)
		FR3	84..115	CDD:409353	8/30 (27%)
		Ig strand D	84..90	CDD:409353	0/5 (0%)
		Ig strand E	94..102	CDD:409353	2/7 (29%)
		Ig strand F	108..115	CDD:409353	4/6 (67%)
		CDR3	116..124	CDD:409353	1/7 (14%)
		FR4	124..130	CDD:409353	1/5 (20%)
		Ig strand G	124..130	CDD:409353	1/5 (20%)
		Ig_3	134..208	CDD:404760	5/18 (28%)
		Ig strand B	153..157	CDD:409353
		Ig strand C	166..170	CDD:409353
		Ig strand E	187..191	CDD:409353
		Ig strand F	201..206	CDD:409353
		Ig strand G	215..218	CDD:409353
		Ig	227..318	CDD:416386
		Ig strand C	256..260	CDD:409353
		Ig strand E	286..290	CDD:409353
		Ig strand F	300..305	CDD:409353
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900