DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and dpr19

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:106 Identity:27/106 - (25%)
Similarity:45/106 - (42%) Gaps:23/106 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILK 128
            |:|...:|:.||.:|..| ..||.:.||||               |..:..:.:...::.|.|..
  Fly    65 KVNSPATVSWIRRKDFQL-LTVGLSTHSSD---------------KRFLVEHTRHMGHWSLRIKA 113

  Fly   129 ASPQVAGSYLCK--VLPSGSVVNTKVTIAEHSLDAIAPESS 167
            ...:..|.|.|:  :.|:.|:|     |....::|:|..||
  Fly   114 VREEDRGFYECQLSIYPTQSIV-----IELKIVEAVAEISS 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 20/85 (24%)
IG_like 70..154 CDD:214653 20/85 (24%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 19/77 (25%)
IGc2 55..125 CDD:197706 18/75 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.