DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and fipi

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_787975.1 Gene:fipi / 33676 FlyBaseID:FBgn0031627 Length:450 Species:Drosophila melanogaster


Alignment Length:146 Identity:38/146 - (26%)
Similarity:60/146 - (41%) Gaps:19/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SPQTKSPNPVASEKINKTLSVTGI---RGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLV 112
            |..:||.:.:..:||..|.:.|.:   .||...:.|:|......:   |.|:|....||.|. ..
  Fly   105 SLHSKSFDLIVYQKITFTENATVMTVKEGEKATILCEVKGEPQPN---VTWHFNGQPISAGA-AD 165

  Fly   113 QPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVN-----TKVTIAEHS-LDAIAPESSTSAA 171
            ...|::.|: .|.|.|.:....|.|.|:.....|:.:     |.:...||. :.:..|..|...|
  Fly   166 DSKFRILAD-GLLINKVTQNDTGEYACRAYQVNSIASDMQERTVLMKIEHKPIWSKTPFVSLKYA 229

  Fly   172 ---GSASSFLGCTVLA 184
               |:|:  |.|..||
  Fly   230 YINGTAT--LMCEALA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 21/91 (23%)
IG_like 70..154 CDD:214653 21/91 (23%)
fipiNP_787975.1 IG_like 33..115 CDD:214653 3/9 (33%)
I-set 128..202 CDD:254352 19/78 (24%)
Ig 133..>193 CDD:299845 18/64 (28%)
IG_like 228..307 CDD:214653 7/18 (39%)
Ig 235..305 CDD:143165 5/11 (45%)
FN3 312..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.