DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and bdl

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:128 Identity:36/128 - (28%)
Similarity:48/128 - (37%) Gaps:31/128 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 TKSPNPVASEKINK--TLSVTGIR------GEDVVLKCDV----GSNLHSSDVVVLWYFGDNVIS 106
            |..|:||.|..:.:  ..|||...      ||...|.|:.    |:|..|    ::|...|    
  Fly   326 TDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPCEAIDRDGNNRPS----IIWGRKD---- 382

  Fly   107 NGKNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTI---AEHSLDAIAPES 166
             |:.|....|.|... :|||........|.|.|      |..|...||   ||..::.|||.:
  Fly   383 -GQPLPADRFSLSGG-NLTITGLVEGDRGIYEC------SATNEAATITAEAELMIENIAPRA 437

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 24/93 (26%)
IG_like 70..154 CDD:214653 24/93 (26%)
bdlNP_608822.1 IG_like 42..128 CDD:214653
Ig 43..131 CDD:299845
I-set 153..242 CDD:254352
Ig 157..242 CDD:299845
Ig_2 252..337 CDD:290606 5/10 (50%)