DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Sdk1

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	NP_808547.3	Gene:	Sdk1 / 330222	MGIID:	2444413	Length:	2193	Species:	Mus musculus

Alignment Length:	136	Identity:	30/136 - (22%)
Similarity:	57/136 - (41%)	Gaps:	9/136 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    43 GGEDQSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISN 107
            |||.|:.......:..|..::   :.:..|...|...||:|:|..   :....:.|..|::::::
Mouse   446 GGEVQTHTYLDVTNIAPAFTQ---RPVDTTVTDGMTAVLRCEVSG---APKPAITWKRGNHILAS 504

  Fly   108 GKNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAIA--PESSTSA 170
            |...: |.|.|..:..|.|.....|.||:|.|....:.:.||....:...:..:|.  ||.....
Mouse   505 GSVRI-PRFMLLESGGLRIAPVFIQDAGNYTCYAANTEASVNASAMLTVWNRTSIVHPPEDRVVI 568

  Fly   171 AGSASS 176
            .|:.::
Mouse   569 KGTTAT 574

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	21/83 (25%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	21/83 (25%)
Sdk1	NP_808547.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..56
		Ig_2	94..169	CDD:290606
		IG_like	100..169	CDD:214653
		IG_like	183..263	CDD:214653
		Ig	197..247	CDD:299845
		IG_like	281..357	CDD:214653
		IGc2	294..347	CDD:197706
		I-set	368..457	CDD:254352	4/10 (40%)
		Ig	388..454	CDD:143165	4/7 (57%)
		I-set	462..552	CDD:254352	22/96 (23%)
		Ig	476..552	CDD:299845	20/79 (25%)
		I-set	557..646	CDD:254352	4/18 (22%)
		Ig	562..646	CDD:299845	3/13 (23%)
		FN3	650..741	CDD:238020
		fn3	753..839	CDD:278470
		FN3	854..949	CDD:238020
		FN3	954..1036	CDD:238020
		FN3	1052..1148	CDD:238020
		FN3	1158..1253	CDD:238020
		FN3	1261..1349	CDD:238020
		FN3	1360..1453	CDD:238020
		FN3	1459..1554	CDD:238020
		FN3	1562..1676	CDD:238020
		FN3	1686..1779	CDD:238020
		FN3	1784..1865	CDD:238020
		FN3	1885..1978	CDD:238020
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2057..2080
		PDZ-binding. /evidence=ECO:0000250\|UniProtKB:Q6V4S5	2187..2193
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900