DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and dpr8

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:149 Identity:36/149 - (24%)
Similarity:64/149 - (42%) Gaps:24/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QSAPSPQTKSPNPVASEKINKTL--SVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGK 109
            |..|:|.|..|.      .:.|:  ::||:.|:.|.|.|.| .||.:..|..:.:...::::.|:
  Fly    32 QDLPTPGTGGPT------FDTTIGTNITGLVGKTVKLTCRV-KNLGNRTVSWVRHRDIHLLTVGR 89

  Fly   110 NLVQPNFKLDA-------NYDLTILKASPQVAGSYLCKVL---PSGSVVNTKVTIAEHSLDAI-A 163
            .....:.:.:|       ::.|.|..|..:.:|.|.|::.   |.|..|  .:.|.|...|.| .
  Fly    90 YTYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSV--YLNIVEPVTDIIGG 152

  Fly   164 PESSTSAAGSASSFLGCTV 182
            ||...:...:.:  |.|.|
  Fly   153 PELHINRGSTIN--LTCIV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 21/93 (23%)
IG_like 70..154 CDD:214653 21/93 (23%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 18/80 (23%)
V-set 52..143 CDD:284989 21/93 (23%)
IG_like 153..238 CDD:214653 5/19 (26%)
ig 153..232 CDD:278476 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.