DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and dpr14

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:123 Identity:31/123 - (25%)
Similarity:49/123 - (39%) Gaps:22/123 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GEDVVLKCDVGSNLHSSDVVVLWYFGDNVI----SNG----KNLVQPNFKLDANYDLTILKASPQ 132
            |..:.|:|.:....|.|..:. |..|..::    |.|    |..:.|...|...|   |..|:.|
  Fly   198 GSTIELQCVISKIPHPSSYIT-WRHGPRLLNYDTSRGGISVKTDMLPGRALSRLY---IANANRQ 258

  Fly   133 VAGSYLCKVLPSGSVVNTKVTIAEHSLDAIAPESSTSAAGSASSFLGCTVLASTVLLL 190
            ..|:|.|.:   |:.:..  |:..|.|:...|.:...|.||...     ..|||:::|
  Fly   259 DTGNYTCML---GNEITE--TVVVHVLNGEEPAAMQHANGSRQK-----ANASTMVVL 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 20/85 (24%)
IG_like 70..154 CDD:214653 20/85 (24%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653
Ig 84..169 CDD:299845
IG_like 191..279 CDD:214653 21/89 (24%)
Ig 201..274 CDD:143165 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.