DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and ncam1a

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	XP_009293555.1	Gene:	ncam1a / 30447	ZFINID:	ZDB-GENE-990415-31	Length:	1010	Species:	Danio rerio

Alignment Length:	145	Identity:	33/145 - (22%)
Similarity:	49/145 - (33%)	Gaps:	61/145 - (42%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 QSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNL 111
            |.|||||          :.|:        |:|..:.|||   :.|....::|.:       .|..
Zfish   118 QYAPSPQ----------EFNE--------GDDADIICDV---ISSPPPTIIWRY-------KKMR 154

  Fly   112 VQP----NFKLDANYDLTILKASPQVAGSYLCK-------------------VLPS--------- 144
            :||    ..|:.:|..|.|........|.|.|:                   ||||
Zfish   155 IQPETDVRLKVLSNNHLQIRGIKKTDEGDYTCEGRIMARGEIDLRVIKVIVNVLPSIRTRYTELN 219

  Fly   145 -GSVVNTKVTIAEHS 158
             .:.:|..||:|.|:
Zfish   220 ATADINQAVTLACHA 234

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	23/116 (20%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	23/116 (20%)
ncam1a	XP_009293555.1	Ig	20..112	CDD:299845
		I-set	21..111	CDD:254352
		IG_like	121..200	CDD:214653	22/106 (21%)
		IGc2	128..189	CDD:197706	17/78 (22%)
		Ig	208..301	CDD:299845	8/27 (30%)
		IG_like	219..298	CDD:214653	5/16 (31%)
		Ig	300..406	CDD:299845
		IG_like	308..406	CDD:214653
		ig	413..498	CDD:278476
		IG_like	415..498	CDD:214653
		fn3	505..589	CDD:278470
		FN3	624..715	CDD:238020
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900