DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Lsamp

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	XP_038944182.1	Gene:	Lsamp / 29561	RGDID:	71102	Length:	378	Species:	Rattus norvegicus

Alignment Length:	132	Identity:	35/132 - (26%)
Similarity:	52/132 - (39%)	Gaps:	28/132 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    51 SPQTKSPNPVASEKINK-TLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNG--KNLV 112
            ||.|....||.|...|: |.::|..:|:..:|:|.|    ...:..|.|.....:|..|  |..:
  Rat    37 SPITIPGLPVRSVDFNRGTDNITVRQGDTAILRCVV----EDKNSKVAWLNRSGIIFAGHDKWSL 97

  Fly   113 QPNFKLD----ANYDLTILKASPQVAGSYLC-----------------KVLPSGSVVNTKVTIAE 156
            .|..:|:    ..|.|.|.|......|||.|                 :|.|..|.:::.||:.|
  Rat    98 DPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNE 162

  Fly   157 HS 158
            .|
  Rat   163 GS 164

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	24/106 (23%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	24/106 (23%)
Lsamp	XP_038944182.1	Ig	55..145	CDD:416386	21/93 (23%)
		FR1	55..71	CDD:409353	4/15 (27%)
		Ig strand A'	56..62	CDD:409353	1/5 (20%)
		Ig strand B	64..72	CDD:409353	2/7 (29%)
		CDR1	72..76	CDD:409353	1/7 (14%)
		FR2	77..84	CDD:409353	2/6 (33%)
		Ig strand C	77..83	CDD:409353	2/5 (40%)
		CDR2	85..95	CDD:409353	2/9 (22%)
		Ig strand C'	87..90	CDD:409353	1/2 (50%)
		Ig strand C'	92..95	CDD:409353	0/2 (0%)
		FR3	96..131	CDD:409353	10/34 (29%)
		Ig strand D	100..107	CDD:409353	1/6 (17%)
		Ig strand E	110..116	CDD:409353	2/5 (40%)
		Ig strand F	123..131	CDD:409353	4/7 (57%)
		CDR3	132..136	CDD:409353	0/3 (0%)
		Ig strand G	136..145	CDD:409353	0/8 (0%)
		FR4	138..145	CDD:409353	0/6 (0%)
		Ig_3	148..218	CDD:404760	6/17 (35%)
		Ig strand A'	155..160	CDD:409353	1/4 (25%)
		Ig strand B	166..173	CDD:409353
		Ig strand C	179..184	CDD:409353
		Ig strand D	190..193	CDD:409353
		Ig strand E	197..203	CDD:409353
		Ig strand F	210..217	CDD:409353
		Ig strand G	224..232	CDD:409353
		Ig_3	235..311	CDD:404760
		Ig strand B	252..256	CDD:409353
		Ig strand C	265..269	CDD:409353
		Ig strand E	290..294	CDD:409353
		Ig strand F	304..309	CDD:409353
		Ig strand G	318..321	CDD:409353
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900