DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Ncam2

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	NP_981954.2	Gene:	Ncam2 / 288280	RGDID:	1303131	Length:	837	Species:	Rattus norvegicus

Alignment Length:	85	Identity:	26/85 - (30%)
Similarity:	39/85 - (45%)	Gaps:	13/85 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    59 PVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKL---DA 120
            |.|.....|:.:.|..|||::.|.|....   |.|..:.|:      .||| |::.|.|.   .:
  Rat   208 PPAIVMPQKSFNATAERGEEMTLTCKASG---SPDPAISWF------RNGK-LIEENEKYILKGS 262

  Fly   121 NYDLTILKASPQVAGSYLCK 140
            |.:||:.....:..|||:||
  Rat   263 NTELTVRNIINKDGGSYVCK 282

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	23/74 (31%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	23/74 (31%)
Ncam2	NP_981954.2	IgI_1_NCAM-2	21..113	CDD:409452
		Ig strand B	38..42	CDD:409452
		Ig strand C	50..54	CDD:409452
		Ig strand E	76..80	CDD:409452
		Ig strand F	90..95	CDD:409452
		Ig strand G	104..107	CDD:409452
		IGc2	128..189	CDD:197706
		Ig strand B	130..139	CDD:409353
		Ig strand C	145..153	CDD:409353
		Ig strand C'	156..159	CDD:409353
		Ig strand D	162..167	CDD:409353
		Ig strand E	168..175	CDD:409353
		IgI_1_MuSK	209..298	CDD:409562	25/84 (30%)
		Ig strand B	228..232	CDD:409562	1/3 (33%)
		Ig strand C	241..245	CDD:409562	0/3 (0%)
		Ig strand E	264..268	CDD:409562	1/3 (33%)
		Ig strand F	278..283	CDD:409562	4/5 (80%)
		Ig strand G	291..294	CDD:409562
		Ig	300..397	CDD:416386
		Ig strand A	300..305	CDD:409353
		Ig strand A'	309..313	CDD:409353
		Ig strand B	317..325	CDD:409353
		Ig strand C	331..337	CDD:409353
		Ig strand C'	340..343	CDD:409353
		Ig strand D	353..359	CDD:409353
		Ig strand E	362..368	CDD:409353
		Ig strand F	376..384	CDD:409353
		Ig strand G	387..397	CDD:409353
		Ig_3	401..479	CDD:404760
		Ig strand B	418..422	CDD:409353
		Ig strand C	431..435	CDD:409353
		Ig strand E	458..462	CDD:409353
		Ig strand F	472..477	CDD:409353
		Ig strand G	486..489	CDD:409353
		FN3	496..588	CDD:238020
		fn3	594..678	CDD:394996
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900