DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and dpr1

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_001286645.1 Gene:dpr1 / 2768858 FlyBaseID:FBgn0040726 Length:367 Species:Drosophila melanogaster


Alignment Length:190 Identity:44/190 - (23%)
Similarity:73/190 - (38%) Gaps:43/190 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ADDDFDYGGEDQSAP-SPQTKSPNP---------VASE---KINKTLSVTGIR------------ 75
            :|..|.....|.||. :.|.|.|.|         :.:|   .::.|.:|..::            
  Fly   105 SDQRFQVLRPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFGPSDLMVK 169

  Fly    76 -GEDVVLKCDVGSNLHSSDVVVLWYFGDNVI-SNGKNLVQPN---FKLDANYD------LTILKA 129
             |.|:.|.|.:....|... .:.||.|..:: ..|:|.:..:   .:::.::.      |.|.:|
  Fly   170 TGSDINLTCKIMQGPHELG-NIFWYKGSEMLDGKGENEIDSSMARIRVEDDWTDGLTSRLKIKRA 233

  Fly   130 SPQVAGSYLC-KVLPSGSVVNTKVTIAEHSLDAIAPESSTSAAGSASSFLG-CTVLASTV 187
            .|...|:|.| ..:...|.|...|.|.||.    |.....|::.|.|.:.| |.:|.|.|
  Fly   234 MPGDTGNYTCVPTVAKTSSVYVHVIIGEHP----AAMQHNSSSNSNSFYCGICCMLLSIV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 21/107 (20%)
IG_like 70..154 CDD:214653 21/107 (20%)
dpr1NP_001286645.1 Ig 59..154 CDD:299845 11/48 (23%)
IG_like 60..150 CDD:214653 10/44 (23%)
IG_like 163..257 CDD:214653 19/94 (20%)
Ig 174..244 CDD:143165 14/70 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.