DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and NEGR1

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:161 Identity:34/161 - (21%)
Similarity:57/161 - (35%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YGGEDQSAPSPQTKSPNPVASEKINKTLSV-------------TGIRGEDVVLKCDVGSNLHSSD 93
            ||.....|...:..:.|.|:...:.|...|             |...|...:::|: |:.:  ..
Human   191 YGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCE-GAGV--PP 252

  Fly    94 VVVLWYFGDNVISNG-KNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEH 157
            ....||.|:..:.|| :.::..||  .....||:...:.:..|:|.|       |...|:.....
Human   253 PAFEWYKGEKKLFNGQQGIIIQNF--STRSILTVTNVTQEHFGNYTC-------VAANKLGTTNA 308

  Fly   158 SLDAIAPESST-SAAGSASSFLGCTVLASTV 187
            ||....|.::. ...|||.....|..|..|:
Human   309 SLPLNPPSTAQYGITGSADVLFSCWYLVLTL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 19/97 (20%)
IG_like 70..154 CDD:214653 19/97 (20%)
NEGR1NP_776169.2 IG 47..135 CDD:214652
IGc2 152..210 CDD:197706 4/18 (22%)
Ig_3 225..301 CDD:372822 17/87 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.