DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Lrit1

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	NP_647547.2	Gene:	Lrit1 / 246214	RGDID:	628607	Length:	623	Species:	Rattus norvegicus

Alignment Length:	115	Identity:	27/115 - (23%)
Similarity:	45/115 - (39%)	Gaps:	29/115 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 EDQSAPSPQ-----TKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLH-------SSD---- 93
            |.:...||:     |...:|:.|..:.: ...|||.|.::..:...|..|:       |||
  Rat   247 ELRKCQSPELRPGVTSIISPLGSTVLLR-CGATGIPGPEMSWRRANGRPLNGTVHQEVSSDGSSW 310

  Fly    94 ------VVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILKASPQVAGSY 137
                  ||.|:..|| .|...||.:..:..|     ::::...||.:..|
  Rat   311 TLLDLPVVSLFDSGD-YICQAKNFLGASETL-----ISLIVTEPQTSTEY 354

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	21/85 (25%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	21/85 (25%)
Lrit1	NP_647547.2	LRRNT	23..61	CDD:214470
		LRR 1	60..81
		LRR_8	63..143	CDD:290566
		leucine-rich repeat	64..84	CDD:275378
		LRR 2	84..105
		leucine-rich repeat	85..132	CDD:275378
		LRR 3	108..128
		LRR_8	131..>176	CDD:290566
		LRR_4	131..172	CDD:289563
		LRR 4	132..153
		leucine-rich repeat	133..156	CDD:275378
		LRR 5	156..177
		leucine-rich repeat	157..180	CDD:275378
		leucine-rich repeat	181..205	CDD:275378
		TPKR_C2	201..>240	CDD:301599
		Ig	257..345	CDD:299845	21/94 (22%)
		IG_like	267..345	CDD:214653	19/84 (23%)
		FN3	431..501	CDD:214495
		LRR 6	525..548
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900