DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Lrit3

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	NP_001274153.1	Gene:	Lrit3 / 242235	MGIID:	2685267	Length:	681	Species:	Mus musculus

Alignment Length:	120	Identity:	28/120 - (23%)
Similarity:	45/120 - (37%)	Gaps:	37/120 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly    71 VTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILKASP---- 131
            :|...|.:|:|:||...  |.:..:. |     ..|:|..:         ||  |:::.||
Mouse   263 ITSALGSNVLLRCDAKG--HPTPQLT-W-----TRSDGSTV---------NY--TVIQESPGEGI 308

  Fly   132 ------------QVAGSYLCKV--LPSGSVVNTKVTIAEHSLDAIAPESSTSAAG 172
                        :.||.|.||.  |...|.....||:.......::|:||..:.|
Mouse   309 RWSIISLTSISHKDAGDYRCKAKNLAGISEAVVTVTVVGGVTTTLSPDSSERSPG 363

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	23/100 (23%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	23/100 (23%)
Lrit3	NP_001274153.1	LRR 1. /evidence=ECO:0000255	56..79
		LRR_8	61..117	CDD:290566
		LRR 2. /evidence=ECO:0000255	80..103
		leucine-rich repeat	83..106	CDD:275378
		LRR 3. /evidence=ECO:0000255	104..128
		LRR_8	105..165	CDD:290566
		LRR_4	106..146	CDD:289563
		leucine-rich repeat	107..130	CDD:275378
		LRR_4	129..170	CDD:289563
		LRR 4. /evidence=ECO:0000255	129..151
		leucine-rich repeat	131..154	CDD:275378
		LRR 5. /evidence=ECO:0000255	152..175
		leucine-rich repeat	155..168	CDD:275378
		Ig	254..335	CDD:299845	21/90 (23%)
		IG_like	263..339	CDD:214653	22/94 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	350..391		4/14 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	425..464
		FN3	489..563	CDD:238020
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900