DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and Sdk2

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_766388.2 Gene:Sdk2 / 237979 MGIID:2443847 Length:2176 Species:Mus musculus


Alignment Length:191 Identity:47/191 - (24%)
Similarity:69/191 - (36%) Gaps:43/191 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RTD--LLIAGLLLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQSAPSPQTKSPNPVASEKIN 66
            |:|  |.|:|||               .||..|......:..||.|::......|   :|.....
Mouse   364 RSDGGLQISGLL---------------PDDTGMLQCFAHNAAGEAQTSTYLAVTS---IAPNITR 410

  Fly    67 KTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQ-PNFKLDANYDLTILKAS 130
            ..|..|.|.|..|||.|:...   :....:.|..|:.::::|.  || |.|.|..:..|.|....
Mouse   411 GPLDSTVIDGMSVVLACETSG---APRPAITWQKGERILASGS--VQLPRFTLLESGSLLISPTH 470

  Fly   131 PQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAIA---------PESSTSAAGSASSFLGCTV 182
            ...||:|.|....|..|       .|.|.|.:.         |:..:...|:.:|.: |.|
Mouse   471 ISDAGTYTCLATNSRGV-------DEASADLVVWARTRITKPPQDQSVIKGTQASMV-CGV 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 23/84 (27%)
IG_like 70..154 CDD:214653 23/84 (27%)
Sdk2NP_766388.2 IG_like 44..113 CDD:214653
IGc2 44..102 CDD:197706
IG_like 124..207 CDD:214653
Ig 136..192 CDD:299845
IG_like 226..308 CDD:214653
IGc2 237..290 CDD:197706
I-set 312..401 CDD:254352 13/51 (25%)
Ig 330..398 CDD:143165 13/48 (27%)
I-set 406..496 CDD:254352 27/101 (27%)
Ig 420..496 CDD:299845 24/87 (28%)
Ig 506..590 CDD:299845 5/19 (26%)
IG_like 506..590 CDD:214653 5/19 (26%)
FN3 594..685 CDD:238020
FN3 697..790 CDD:238020
FN3 798..894 CDD:238020
FN3 899..987 CDD:238020
FN3 997..1091 CDD:238020
FN3 1103..1198 CDD:238020
FN3 1205..1294 CDD:238020
FN3 1305..1398 CDD:238020
FN3 1404..1488 CDD:238020
FN3 1507..1620 CDD:238020
FN3 1630..1723 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1712..1734
FN3 1728..1809 CDD:238020
FN3 1841..1920 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2013..2032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2043..2070
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2102..2176
PDZ-binding. /evidence=ECO:0000269|PubMed:20219992 2170..2176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.