DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and SDK1

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	NP_689957.3	Gene:	SDK1 / 221935	HGNCID:	19307	Length:	2213	Species:	Homo sapiens

Alignment Length:	140	Identity:	31/140 - (22%)
Similarity:	59/140 - (42%)	Gaps:	10/140 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    43 GGEDQSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISN 107
            |||.|:.......:..||.::   :.:..|...|...:|:|:|..   :....:.|...::::::
Human   464 GGEIQTHTYLDVTNIAPVFTQ---RPVDTTVTDGMTAILRCEVSG---APKPAITWKRENHILAS 522

  Fly   108 GKNLVQPNFKLDANYDLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHSLDAIA--PESSTSA 170
            |...: |.|.|..:..|.|.....|.||:|.|....:...:|...|:...:..:|.  ||.....
Human   523 GSVRI-PRFMLLESGGLQIAPVFIQDAGNYTCYAANTEGSLNASATLTVWNRTSIVHPPEDHVVI 586

  Fly   171 AGSASSFLGC 180
            .|:.:: |.|
Human   587 KGTTAT-LHC 595

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	18/83 (22%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	18/83 (22%)
SDK1	NP_689957.3	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..73
		I-set	104..188	CDD:254352
		Ig	122..176	CDD:143165
		Ig	219..265	CDD:299845
		IGc2	312..364	CDD:197706
		I-set	386..475	CDD:254352	4/10 (40%)
		Ig	404..472	CDD:143165	4/7 (57%)
		I-set	480..570	CDD:254352	21/96 (22%)
		Ig	494..570	CDD:299845	18/79 (23%)
		I-set	575..664	CDD:254352	6/22 (27%)
		Ig	580..664	CDD:299845	5/17 (29%)
		FN3	668..759	CDD:238020
		fn3	771..857	CDD:278470
		FN3	872..967	CDD:238020
		FN3	972..1054	CDD:238020
		FN3	1070..1166	CDD:238020
		FN3	1176..1271	CDD:238020
		fn3	1279..1365	CDD:278470
		FN3	1378..1471	CDD:238020
		FN3	1477..1572	CDD:238020
		FN3	1580..1694	CDD:238020
		FN3	1704..1797	CDD:238020
		FN3	1802..1883	CDD:238020
		FN3	1903..1996	CDD:238020
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	2075..2098
		PDZ-binding. /evidence=ECO:0000250\|UniProtKB:Q6V4S5	2207..2213
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900