DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Ncam2

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	NP_001106679.1	Gene:	Ncam2 / 17968	MGIID:	97282	Length:	837	Species:	Mus musculus

Alignment Length:	85	Identity:	26/85 - (30%)
Similarity:	39/85 - (45%)	Gaps:	13/85 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly    59 PVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKL---DA 120
            |.|.....|:.:.|..|||::.|.|....   |.|..:.|:      .||| |::.|.|.   .:
Mouse   208 PPAIMMPQKSFNATAERGEEMTLTCKASG---SPDPTISWF------RNGK-LIEENEKYILKGS 262

  Fly   121 NYDLTILKASPQVAGSYLCK 140
            |.:||:.....:..|||:||
Mouse   263 NTELTVRNIINKDGGSYVCK 282

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	23/74 (31%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	23/74 (31%)
Ncam2	NP_001106679.1	Ig1_NCAM-2	21..112	CDD:143274
		I-set	22..111	CDD:254352
		I-set	117..193	CDD:254352
		IGc2	128..189	CDD:197706
		Ig	208..301	CDD:299845	26/85 (31%)
		I-set	215..298	CDD:254352	24/78 (31%)
		Ig	300..397	CDD:299845
		IG_like	308..395	CDD:214653
		IG_like	413..491	CDD:214653
		IGc2	414..482	CDD:197706
		FN3	496..588	CDD:238020
		fn3	594..678	CDD:278470
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	764..810
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900