DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and Ncam1

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:121 Identity:31/121 - (25%)
Similarity:49/121 - (40%) Gaps:40/121 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QSAPSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLW-YFGDNVI--SNG 108
            ::||:||...                  .|||.|:.|||.|:|..:   ::| :.|.:||  .:.
Mouse   121 KNAPTPQEFK------------------EGEDAVIVCDVVSSLPPT---IIWKHKGRDVILKKDV 164

  Fly   109 KNLVQPNFKLDANYDLTILKASPQVAGSYLC--KVLPSGS--------VVNTKVTI 154
            :.:|..|     || |.|........|:|.|  ::|..|.        :||...|:
Mouse   165 RFIVLSN-----NY-LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 26/96 (27%)
IG_like 70..154 CDD:214653 26/96 (27%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 24/92 (26%)
Ig3_NCAM-1_like 211..308 CDD:143207 1/4 (25%)
Ig_NCAM-1 307..413 CDD:143277
Ig_3 417..494 CDD:372822
FN3 509..606 CDD:238020
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.