DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and zig-8

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:141 Identity:34/141 - (24%)
Similarity:57/141 - (40%) Gaps:25/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVV-VLWYFGDNVIS-NGKNLVQPNFKLD 119
            |:|.:.:| ..|..:..:.|::|||.|.|.|.....:|: |:|....|.|: |.........|.|
 Worm   140 PSPSSLQK-KSTKLMANMSGDEVVLNCTVTSTDKDEEVLDVVWTRDGNTINFNDTEKYILKVKRD 203

  Fly   120 ANY---DLTILKASPQVAGSYLCKVLPSGSVVNTKVTIAEHS---LDAIAPESSTSAAGSASSFL 178
            |..   .:.|.||:.:..|:|.|                |||   ...|...:...|..|.|:..
 Worm   204 AGVVIETMRIRKATMEDDGNYAC----------------EHSQQKASQIVHINKAEAQTSNSATF 252

  Fly   179 GCTVLASTVLL 189
            .|::.:.::.:
 Worm   253 PCSIFSISIFM 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 22/88 (25%)
IG_like 70..154 CDD:214653 22/88 (25%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653
Ig 55..129 CDD:143165
ig 158..229 CDD:278476 23/86 (27%)
IG_like 158..227 CDD:214653 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.