DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and Dscam

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_038943864.1 Gene:Dscam / 171119 RGDID:619992 Length:2034 Species:Rattus norvegicus


Alignment Length:135 Identity:34/135 - (25%)
Similarity:49/135 - (36%) Gaps:45/135 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PSPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGK----- 109
            |...|.||..|.|       ||    |..|.|.|.|..|   .|..:.||....:::.||     
  Rat   313 PLKATISPRKVKS-------SV----GSQVSLSCSVTGN---EDQELSWYRNGEILNPGKNVRIT 363

  Fly   110 -----NLVQPNF---------------KLDA-NYDLTILK-ASPQVAGSYLCKVL----PSGSVV 148
                 ||:..:.               ||.| :|...:|: .:|::..::..||:    |...|.
  Rat   364 GLNHANLIMDHMVKSDGGAYQCFVRKDKLSAQDYVQVVLEDGTPKIISAFSEKVVSPAEPVSLVC 428

  Fly   149 NTKVT 153
            |.|.|
  Rat   429 NVKGT 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 28/115 (24%)
IG_like 70..154 CDD:214653 28/115 (24%)
DscamXP_038943864.1 Ig 26..121 CDD:416386
Ig strand A' 33..37 CDD:409353
Ig strand B 40..49 CDD:409353
Ig strand C 55..61 CDD:409353
Ig strand C' 63..66 CDD:409353
Ig strand D 72..75 CDD:409353
Ig strand E 80..85 CDD:409353
Ig strand F 98..106 CDD:409353
Ig strand G 109..121 CDD:409353
Ig 125..210 CDD:416386
Ig strand A 126..130 CDD:409353
Ig strand A' 132..136 CDD:409353
Ig strand B 139..149 CDD:409353
Ig strand C 157..163 CDD:409353
Ig strand C' 164..167 CDD:409353
Ig strand E 179..185 CDD:409353
Ig strand F 191..201 CDD:409353
IGc2 239..300 CDD:197706
Ig strand B 242..246 CDD:409353
Ig strand C 255..259 CDD:409353
Ig strand F 290..295 CDD:409353
Ig 313..395 CDD:416386 23/95 (24%)
Ig strand A 314..319 CDD:409353 1/4 (25%)
Ig strand A' 322..326 CDD:409353 2/10 (20%)
Ig strand B 329..339 CDD:409353 4/9 (44%)
Ig strand C 344..350 CDD:409353 2/5 (40%)
Ig strand C' 351..354 CDD:409353 0/2 (0%)
Ig strand E 368..374 CDD:409353 2/5 (40%)
Ig strand F 381..389 CDD:409353 0/7 (0%)
Ig 406..501 CDD:416386 8/28 (29%)
Ig strand A 406..409 CDD:409353 1/2 (50%)
Ig strand A' 415..419 CDD:409353 2/3 (67%)
Ig strand B 422..431 CDD:409353 3/8 (38%)
Ig strand C 436..442 CDD:409353
Ig strand C' 444..447 CDD:409353
Ig strand D 452..460 CDD:409353
Ig strand E 464..473 CDD:409353
Ig strand F 480..488 CDD:409353
Ig strand G 491..501 CDD:409353
Ig 504..593 CDD:416386
Ig strand A 505..507 CDD:409353
Ig strand A' 512..516 CDD:409353
Ig strand B 519..526 CDD:409353
Ig strand C 533..539 CDD:409353
Ig strand C' 540..542 CDD:409353
Ig strand D 549..553 CDD:409353
Ig strand E 557..563 CDD:409353
Ig strand F 571..579 CDD:409353
Ig strand G 583..593 CDD:409353
Ig 596..686 CDD:416386
Ig strand A 597..599 CDD:409353
Ig strand B 611..620 CDD:409353
Ig strand C 625..632 CDD:409353
Ig strand C' 634..636 CDD:409353
Ig strand D 643..648 CDD:409353
Ig strand E 651..658 CDD:409353
Ig strand F 665..673 CDD:409353
Ig strand G 676..685 CDD:409353
Ig_DSCAM 689..784 CDD:409397
Ig strand B 707..711 CDD:409397
Ig strand C 720..724 CDD:409397
Ig strand E 749..753 CDD:409397
Ig strand F 763..768 CDD:409397
Ig strand G 777..780 CDD:409397
Ig_DSCAM 785..884 CDD:409398
Ig strand B 805..809 CDD:409398
Ig strand C 818..822 CDD:409398
Ig strand E 848..852 CDD:409398
Ig strand F 862..867 CDD:409398
Ig strand G 875..878 CDD:409398
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig_3 1287..1363 CDD:404760
Ig strand B 1303..1307 CDD:409353
Ig strand C 1316..1320 CDD:409353
Ig strand E 1342..1346 CDD:409353
Ig strand F 1356..1361 CDD:409353
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.