DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and Cntn1

DIOPT Version :10

Sequence 1:NP_611667.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_476459.1 Gene:Cntn1 / 117258 RGDID:621300 Length:1021 Species:Rattus norvegicus


Alignment Length:155 Identity:40/155 - (25%)
Similarity:66/155 - (42%) Gaps:26/155 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IVGSAAVISYPQSSMDDDQMQADDDFDY-------GGEDQSAPSPQTKSPNPVASEKINKTLSVT 72
            :|.|:.::.:...|::.:.:..:|...|       .|:..|..:....:|..:....||..::| 
  Rat   455 LVNSSRILIWEDGSLEINNITRNDGGIYTCFAENNRGKANSTGTLVITNPTRIILAPINADITV- 518

  Fly    73 GIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLV----QPNFKLDANYDLTILKASPQV 133
               ||:..::| ..|...|.|:..:|.|...||...|.:.    |.||.||||.:|.|..|..:.
  Rat   519 ---GENATMQC-AASFDPSLDLTFVWSFNGYVIDFNKEITNIHYQRNFMLDANGELLIRNAQLKH 579

  Fly   134 AGSYLCKVLPSGSVVNTKVTIAEHS 158
            ||.|.|          |..||.::|
  Rat   580 AGRYTC----------TAQTIVDNS 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_611667.1 ig 70..154 CDD:395002 27/87 (31%)
Ig strand B 79..83 CDD:409368 0/3 (0%)
Ig strand C 95..99 CDD:409368 0/3 (0%)
Ig strand E 122..126 CDD:409368 1/3 (33%)
Cntn1NP_476459.1 IgI_1_Contactin-1 40..134 CDD:409436
Ig strand A 42..46 CDD:409436
Ig strand A' 49..54 CDD:409436
Ig strand B 60..68 CDD:409436
Ig strand C 73..79 CDD:409436
Ig strand C' 81..84 CDD:409436
Ig strand D 90..94 CDD:409436
Ig strand E 96..102 CDD:409436
Ig strand F 109..118 CDD:409436
Ig strand G 121..134 CDD:409436
Ig2_Contactin-2-like 142..230 CDD:409392
Ig strand A 144..149 CDD:409392
Ig strand B 153..159 CDD:409392
Ig strand C 168..174 CDD:409392
Ig strand C' 179..181 CDD:409392
Ig strand D 186..191 CDD:409392
Ig strand E 194..198 CDD:409392
Ig strand F 208..216 CDD:409392
Ig strand G 218..230 CDD:409392
IgI_3_Contactin-1 241..328 CDD:143259
Ig strand A 241..246 CDD:143259
Ig strand A' 249..254 CDD:143259
Ig strand B 257..266 CDD:143259
Ig strand C 272..276 CDD:143259
Ig strand C' 279..281 CDD:143259
Ig strand D 289..292 CDD:143259
Ig strand E 293..298 CDD:143259
Ig strand F 306..314 CDD:143259
Ig strand G 317..328 CDD:143259
Ig 332..408 CDD:472250
Ig strand B 348..352 CDD:409353
Ig strand C 361..365 CDD:409353
Ig strand E 374..378 CDD:409353
Ig strand F 388..393 CDD:409353
Ig strand G 401..404 CDD:409353
Ig5_Contactin-1 413..501 CDD:409438 7/45 (16%)
Ig strand A 413..418 CDD:409438
Ig strand A' 421..426 CDD:409438
Ig strand B 430..437 CDD:409438
Ig strand C 445..449 CDD:409438
Ig strand D 463..466 CDD:409438 0/2 (0%)
Ig strand E 467..472 CDD:409438 1/4 (25%)
Ig strand F 480..488 CDD:409438 1/7 (14%)
Ig strand G 494..501 CDD:409438 1/6 (17%)
Ig6_Contactin 503..603 CDD:409359 33/107 (31%)
Ig strand A 503..509 CDD:409359 1/5 (20%)
Ig strand A' 512..517 CDD:409359 2/4 (50%)
Ig strand B 520..528 CDD:409359 2/8 (25%)
Ig strand C 537..541 CDD:409359 0/3 (0%)
Ig strand D 564..567 CDD:409359 2/2 (100%)
Ig strand E 568..572 CDD:409359 1/3 (33%)
Ig strand F 581..588 CDD:409359 4/16 (25%)
Ig strand G 595..599 CDD:409359 40/155 (26%)
FN3 612..699 CDD:238020
FN3 650..>947 CDD:442628
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 695..719
fn3 813..895 CDD:394996
FN3 907..991 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.