DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Dscaml1

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	NP_001074739.2	Gene:	Dscaml1 / 114873	MGIID:	2150309	Length:	2053	Species:	Mus musculus

Alignment Length:	96	Identity:	23/96 - (23%)
Similarity:	38/96 - (39%)	Gaps:	21/96 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    58 NPVASEKINKTLSV--------------TGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNG 108
            |...|.:.|..|:|              ||| |..|:|.|.:..   |.:..:.||....::..|
Mouse   298 NTFGSAEANGILTVIDPLHVTLTPKKLKTGI-GSTVILSCALTG---SPEFTIRWYRNTELVLPG 358

  Fly   109 KNLVQPNFKLDANYDLTILKASPQVAGSYLC 139
            :.:   :.:..:|..|.|..|....:|:|.|
Mouse   359 EAI---SIRGLSNETLLISSAQKSHSGAYQC 386

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	19/84 (23%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	19/84 (23%)
Dscaml1	NP_001074739.2	IGc2	43..110	CDD:197706
		Ig	125..218	CDD:353325
		I-set	226..311	CDD:336764	4/12 (33%)
		Ig_3	317..389	CDD:339005	18/77 (23%)
		Ig	408..498	CDD:353325
		IGc2	519..577	CDD:197706
		Ig	615..681	CDD:319273
		Ig_DSCAM	707..785	CDD:143211
		Ig	803..891	CDD:353325
		FN3	887..981	CDD:238020
		FN3	988..1085	CDD:238020
		FN3	1093..1186	CDD:238020
		FN3	1191..1282	CDD:238020
		Ig	1307..1377	CDD:319273
		FN3	1384..1474	CDD:238020
		FN3	1488..1560	CDD:238020
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1716..1741
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1773..1803
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1840..1862
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1974..2053
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900