DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and Kirrel2

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	XP_038957463.1	Gene:	Kirrel2 / 100359836	RGDID:	1308456	Length:	711	Species:	Rattus norvegicus

Alignment Length:	193	Identity:	43/193 - (22%)
Similarity:	64/193 - (33%)	Gaps:	64/193 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly    13 LLIVGSAAVISYPQSSMDDDQMQADDDFDYGGEDQS-------APSPQTKSPNPVASEKINKTLS 70
            |.:|..|..::.|.|....:.:        |..::|       .|..|.| |.||:.:.
  Rat   284 LEVVADATFLTEPVSCEVSNAV--------GSANRSTALEVLYGPILQAK-PKPVSVDV------ 333

  Fly    71 VTGIRGEDVVLKCDVGSNLHSSDVVVLW--YFGDNVISNGKNLVQPNFKLDANYDLTILKASPQV 133
                 |:|....|....|....   :.|  ..|..|:|:|..|..|:..|:.
  Rat   334 -----GKDASFSCVWRGNPLPR---ISWTRLGGSQVLSSGPTLRLPSVALED------------- 377

  Fly   134 AGSYLCKVLP-----SGSVVNTKVTIAEHSLDAIAPESSTSAAGSASSF------LGCTVLAS 185
            ||.|:|:..|     .|.....::|:.       ||...| |...|.:|      |.|.|.||
  Rat   378 AGDYVCRAEPRRTGVGGGTAQARLTVN-------APPVVT-ALHPAPAFLRGPARLQCVVFAS 432

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	18/90 (20%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	18/90 (20%)
Kirrel2	XP_038957463.1	IG_like	38..127	CDD:214653
		Ig strand A'	40..44	CDD:409353
		Ig strand B	48..57	CDD:409353
		Ig strand C	62..66	CDD:409353
		Ig strand D	75..85	CDD:409353
		Ig strand E	88..100	CDD:409353
		Ig strand F	107..115	CDD:409353
		Ig strand G	117..127	CDD:409353
		Ig	133..231	CDD:416386
		Ig strand A	134..137	CDD:409353
		Ig strand A'	140..144	CDD:409353
		Ig strand B	151..158	CDD:409353
		Ig strand C	164..169	CDD:409353
		Ig strand C'	172..174	CDD:409353
		Ig strand D	177..184	CDD:409353
		Ig strand E	191..199	CDD:409353
		Ig strand F	208..216	CDD:409353
		Ig strand G	222..228	CDD:409353
		Ig_3	234..303	CDD:404760	5/18 (28%)
		Ig strand B	252..256	CDD:409353
		Ig strand C	266..270	CDD:409353
		Ig strand E	283..286	CDD:409353	1/1 (100%)
		Ig strand F	292..301	CDD:409353	2/8 (25%)
		Ig strand G	309..312	CDD:409353	0/2 (0%)
		Ig	326..403	CDD:416386	21/103 (20%)
		Ig strand A'	327..332	CDD:409353	2/4 (50%)
		Ig strand B	335..344	CDD:409353	2/8 (25%)
		Ig strand C	350..354	CDD:409353	0/6 (0%)
		Ig strand C'	357..359	CDD:409353	0/1 (0%)
		Ig strand D	362..365	CDD:409353	1/2 (50%)
		Ig strand E	366..371	CDD:409353	1/4 (25%)
		Ig strand F	379..387	CDD:409353	3/7 (43%)
		Ig strand G	393..403	CDD:409353	1/9 (11%)
		Ig	405..509	CDD:416386	11/29 (38%)
		Ig strand A	406..410	CDD:409353	1/3 (33%)
		Ig strand A'	412..415	CDD:409353	0/2 (0%)
		Ig strand B	423..430	CDD:409353	2/6 (33%)
		Ig strand C	437..442	CDD:409353
		Ig strand C'	444..447	CDD:409353
		Ig strand D	455..462	CDD:409353
		Ig strand E	472..479	CDD:409353
		Ig strand F	490..497	CDD:409353
		Ig strand G	500..507	CDD:409353
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900